PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 661aa    MW: 72637.5 Da    PI: 6.1674
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029880.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB152.86.3e-48188895
        NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                 +Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++cqre+rkt++g+d+lwa+++lGf++yvepl++yl++yre e+
  Pbr029880.1  1 MPIANVIRIMRRILPPHAKISDDAKETMQECVSEYIAFITGEANERCQREQRKTVTGEDVLWAMGKLGFDNYVEPLTIYLQRYRESES 88
                 8************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.0E-451101IPR009072Histone-fold
SuperFamilySSF471132.85E-351100IPR009072Histone-fold
PfamPF008086.2E-24164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-152846No hitNo description
PRINTSPR006151.8E-154765No hitNo description
PRINTSPR006151.8E-156684No hitNo description
CDDcd003711.44E-6214260No hitNo description
SuperFamilySSF550083.4E-6215265IPR006121Heavy metal-associated domain, HMA
PROSITE profilePS5084610.05216261IPR006121Heavy metal-associated domain, HMA
Gene3DG3DSA:3.30.70.1002.7E-6216262No hitNo description
SuperFamilySSF550088.9E-17264339IPR006121Heavy metal-associated domain, HMA
PROSITE profilePS5084619.924269335IPR006121Heavy metal-associated domain, HMA
Gene3DG3DSA:3.30.70.1004.3E-20270339No hitNo description
CDDcd003713.77E-13272334No hitNo description
PfamPF004031.3E-7272331IPR006121Heavy metal-associated domain, HMA
PROSITE patternPS010470274303IPR017969Heavy-metal-associated, conserved site
SuperFamilySSF550082.88E-13338411IPR006121Heavy metal-associated domain, HMA
Gene3DG3DSA:3.30.70.1001.9E-12340410No hitNo description
PROSITE profilePS5084614.279344410IPR006121Heavy metal-associated domain, HMA
PfamPF004033.7E-9360407IPR006121Heavy metal-associated domain, HMA
CDDcd003719.44E-7361414No hitNo description
Gene3DG3DSA:1.20.1110.103.7E-24587656IPR023298P-type ATPase, transmembrane domain
SuperFamilySSF567841.11E-18593658IPR023214HAD-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030001Biological Processmetal ion transport
GO:0046872Molecular Functionmetal ion binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MPIANVIRIM RRILPPHAKI SDDAKETMQE CVSEYIAFIT GEANERCQRE QRKTVTGEDV  60
LWAMGKLGFD NYVEPLTIYL QRYRESESSD RSQFVKREEL QLMEYYPPGH AGQVAMMPPS  120
PPSYGPGYYF GPQHGPPMYD PSMMGMFRDG SSSGAGGGGS SSASGAQGEN SLGGFDPVRT  180
RWGDLTRLVT SNDHHCLKKG LSCLINRRNE YIVALTIESV LGKLDGIKSA TVSPIEGQAA  240
VNYIPELINE AVEDAGFPVS EFPQQDVAVC RLRIKGMACT SCSESVKCAL RMVDGVRNAV  300
VGLSLEEAKV RFDPNLTDTS CIIQAIEDAG FGAELVSSGN DVNKLHLKLE GVDSPEDMTV  360
VQSVIESVEG VSNVKVDLAE KKVTITYDSD LTGPRSLIRC IEEAGHESKV YRASLSVPPR  420
PREAERKHEI QMYRNQFFLS CLFSVPIFLF SMVLPMLPPF GNWLDYMVHN MLTVRMLLRW  480
TLCTPVQFIV GRSISGCLPL WLGISNPPAI MVATGRVLCK VFLSRVEMHL KRLISWNLSH  540
MNLWFWTVGG CMHLVHVSKP YSPSSRSPFL VDNSSHGGRA IPNSFFDKLQ TKGMAVAMVG  600
DGINDSPALV AADVGMAIGA GTDVAIEATD IVLMNSNLED VVTAIDLSRK TMSQIRLNYV  660
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-34185993NF-YB
4awl_B3e-341851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-341851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM5X9L71e-158M5X9L7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g01890.t011e-129(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-48nuclear factor Y, subunit B6